Prediction of BiP-binding peptides

Submit protein sequences to predict their affinity to the chaperone BiP. The length of predicted peptides is 7 amino acids. Longer sequences will be split into all possible 7mers. Sequences are scored in forward and reverse directions to account for alternative binding modes.

Submit Protein Sequences
Examples

Example 1:

APITAYAQQTRGLLGCIITSLTGRDKNQVE

Example 2:

>protein_1
APITAYAQQTRGLLGCIITSLTGRDKNQVE
>protein_2
PADEDMWDETELGLYKVNEYVDARDTNMGA